Kisspeptin-54 (human) trifluoroacetate salt,CAS:374683-24-6
Kisspeptin-54 (human) trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-930 | 0.5mg | 545.00 | + Add to cart |
|
R-M-930 | 1mg | 1010.00 | + Add to cart |
|
|
Product description
Kisspeptin-54, an endogenous ligand of the G protein-coupled receptor GPR54, is a key regulator of the hypothalamo-pituitary-gonadal (HPG) axis. It stimulates LH and FSH secretion. Kisspeptin-54 may represent a versatile tool for the manipulation of the HPG axis.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 374683-24-6 |
Sequence | GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂ |
Molecular Formula | Metastin (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (68-121) (human), KiSS-1 (68-121) (human) |
Molecular Formula | C₂₅₈H₄₀₁N₇₉O₇₈ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product